PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi04g07220.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family MYB_related
Protein Properties Length: 148aa    MW: 16688.3 Da    PI: 10.639
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi04g07220.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.34.1e-145193246
                     SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                     +++Tt+E++l++++++  G++ W+ Ia+ ++ gRt++++k +w++
  Vradi04g07220.1 51 DNFTTQEEDLIIKLHAAIGSR-WSIIAQQLP-GRTDNDVKIYWNT 93
                     68*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500904.217740IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.604.7E-61554IPR009057Homeodomain-like
SuperFamilySSF466891.66E-161591IPR009057Homeodomain-like
PROSITE profilePS5129417.7134599IPR017930Myb domain
SMARTSM007173.1E-124997IPR001005SANT/Myb domain
PfamPF002491.4E-125293IPR001005SANT/Myb domain
CDDcd001679.20E-95295No hitNo description
Gene3DG3DSA:1.10.10.602.1E-195599IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 148 aa     Download sequence    Send to blast
MVRSPCEQDT KKLAFGSKHG SGNWTSVPRK TRLKRCGKSC SRLRWTDLKH DNFTTQEEDL  60
IIKLHAAIGS RWSIIAQQLP GRTDNDVKIY WNTKLKKKLS QMGIDPVTHK PFSKLIADYG  120
NIGGCQKPRK RHPGFKGECG DHTACLR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-161995108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150353e-84AP015035.1 Vigna angularis var. angularis DNA, chromosome 2, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014496825.13e-81PREDICTED: transcription factor MYB35-like
SwissprotQ9LSI71e-46MYB35_ARATH; Transcription factor MYB35
TrEMBLA0A0S3RG075e-82A0A0S3RG07_PHAAN; Uncharacterized protein
TrEMBLA0A0L9UCS85e-82A0A0L9UCS8_PHAAN; Uncharacterized protein
STRINGGLYMA04G34631.17e-70(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF29423474
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28470.16e-48MYB family protein